PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca005143G02
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 257aa    MW: 29116.8 Da    PI: 8.5711
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca005143G02genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431.1e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed++l+ +++ +G g W+  +++ g++R+  +c++rw +yl
  Gh_Sca005143G02 14 KGAWTDWEDKILASYINVHGEGKWRNLPKRAGLKRCCRSCRLRWVNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding513.3e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Gh_Sca005143G02  67 RGNISHDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                      78999*****************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-20564IPR009057Homeodomain-like
PROSITE profilePS5129411.736961IPR017930Myb domain
SuperFamilySSF466894.3E-2611108IPR009057Homeodomain-like
SMARTSM007175.6E-111363IPR001005SANT/Myb domain
PfamPF002493.5E-121461IPR001005SANT/Myb domain
CDDcd001671.80E-81661No hitNo description
PROSITE profilePS5129424.38462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-2465115IPR009057Homeodomain-like
SMARTSM007172.9E-1566114IPR001005SANT/Myb domain
PfamPF002492.2E-1467111IPR001005SANT/Myb domain
CDDcd001679.65E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGKSSCCSKE GLRKGAWTDW EDKILASYIN VHGEGKWRNL PKRAGLKRCC RSCRLRWVNY  60
LRPDIKRGNI SHDEEELIIR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT TLSKRTKAQA  120
SIKYPRPTIQ TKATGCSSKV MVPTQPSTSQ DIDELRDGKL YSTNNSQEMG GDIATVEAHN  180
GTQVLDSLKS DGGSNLLSFE INGLRKASDA KFEENHMQLL PFDKAMFEDW TTYPYLNDTA  240
ATGWDSLAFL IDTNDWP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-211211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461891e-133
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362841e-130AF336284.1 Gossypium hirsutum GHMYB36 (ghmyb36) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487897.11e-176PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0D2QJI61e-176A0A0D2QJI6_G
STRINGVIT_04s0008g01800.t017e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3723322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.18e-60MYB family protein